Abstract: The 2006 VIP Peptide Market report provides a comprehensive analysis of product composition, focusing on vasoactive intestinal peptide variants and their formulations. Industry outlook highlights steady growth driven by expanding research in neuroprotection and gastrointestinal disorders. Comparative data evaluates efficacy, purity, and stability across leading suppliers. A selection guide offers criteria for sourcing high-quality peptides, while industry knowledge addresses regulatory trends and manufacturing standards. This report serves as a critical resource for researchers and procurement professionals navigating the evolving peptide landscape.
Target Keyword: vip peptide
The VIP peptide, or Vasoactive Intestinal Peptide, is a 28-amino-acid neuropeptide belonging to the glucagon/secretin superfamily. It functions as a key neurotransmitter and immunomodulator in both the central and peripheral nervous systems. For B2B buyers—including research laboratories, cosmetic formulation scientists, and bulk raw material distributors—the core value of VIP peptide lies in its high specificity for VPAC1 and VPAC2 receptors, enabling targeted studies in neuroprotection, gastrointestinal motility, and anti-inflammatory pathways.
Industry data from the 2026 VIP Peptide Market report indicates that global demand for high-purity VIP (≥98%) grew by 12.3% year-over-year in 2025, driven by expanded research in Alzheimer’s disease and inflammatory bowel disease. The average price per 10 mg vial for GMP-grade material ranges from $450 to $680, reflecting stringent manufacturing standards.
VIP peptide production employs solid-phase peptide synthesis (SPPS) using Fmoc chemistry on a Rink amide resin, ensuring C-terminal amidation critical for biological activity. The process includes automated coupling cycles, cleavage with TFA/TIS/H2O (95:2.5:2.5), and global deprotection. Purification via preparative reverse-phase HPLC achieves >98% purity, followed by lyophilization under controlled vacuum conditions.
In cosmetic formulation, VIP peptide is incorporated into anti-aging serums at 0.05–0.1% concentration, leveraging its vasodilatory properties to enhance microcirculation and reduce periorbital wrinkles. For lab research, it serves as a standard agonist in VPAC receptor binding assays and cAMP quantification studies. Bulk wholesale buyers typically order 100 mg to 1 kg quantities for preclinical trials or large-scale screening programs.
| Item | Our Product (VIP Peptide) | Alternatives (Low-Grade Peptides) | Advantages |
|---|---|---|---|
| Purity | ≥98% (HPLC) | 85–92% (HPLC) | Higher purity reduces non-specific binding in assays |
| Stability | Lyophilized, stable 24 months at -20°C | Often degraded after 6 months at -20°C | Longer shelf life reduces waste and reordering costs |
| Endotoxin | <0.5 EU/mg | 1–5 EU/mg | Safe for cell culture and in vivo studies |
| Bioactivity | EC50 0.5–2 nM (cAMP assay) | EC50 5–20 nM (cAMP assay) | Higher potency requires lower doses for experiments |
Common pitfalls when sourcing VIP peptide include accepting low-purity material (≤95%) that leads to inconsistent bioassay results, and neglecting to verify endotoxin levels for cell-based work. Selection standards require reviewing the COA for peptide content (should be 85–95% by weight) and requesting a stability report for long-term storage. A buyer checklist should include: (1) confirm HPLC chromatogram shows single peak at retention time 12–14 min, (2) verify mass spec matches theoretical mass of 3325.8 Da, (3) request batch-specific bioactivity data, (4) check storage conditions match your facility capabilities, and (5) evaluate supplier lead time and minimum order quantities.
Our VIP peptide offers purity ≥98% verified by HPLC and MALDI-TOF, ensuring reliable receptor activation in every experiment. Stability is guaranteed through lyophilization with trehalose excipient, maintaining >95% integrity after 12 months at -20°C. Cost performance is optimized via direct manufacturing, providing 15–20% lower pricing than competitors for equivalent GMP-grade material. Technical support includes free reconstitution protocols, custom packaging options, and expedited shipping for urgent research needs.
Q1: What is the recommended storage condition for reconstituted VIP peptide?
Reconstituted VIP peptide should be stored at 4°C and used within 7 days. For longer storage, aliquot and freeze at -20°C for up to 3 months, avoiding repeated freeze-thaw cycles.
Q2: How do I verify the purity of VIP peptide upon receipt?
Request the COA with HPLC chromatogram showing a single peak at >98% area. Optionally, run a MALDI-TOF mass spec to confirm the molecular weight of 3325.8 Da.
Q3: Can VIP peptide be used in cosmetic formulations with other active ingredients?
Yes, but compatibility testing is recommended. Avoid formulations with high concentrations of ethanol (>10%) or strong acids (pH <4.0) that may degrade the peptide. Use liposomal encapsulation for enhanced stability.
VIP peptide wholesale demands rigorous attention to purity and manufacturing standards to ensure reliable research outcomes. This guide positions high-grade VIP peptide as a critical reagent for laboratory studies, emphasizing 98%+ purity verified by HPLC and mass spectrometry. Sourced from GMP-certified facilities, the product adheres to strict pharmaceutical-grade manufacturing protocols, eliminating common buyer pain points like inconsistent potency or undocumented supply chains. Key quality advantages include batch-specific Certificates of Analysis, endotoxin-free processing, and lyophilized powder stability for extended shelf life. Researchers gain confidence through transparent sourcing documentation and third-party testing reports. The article systematically navigates specifications, certification requirements, and supplier vetting criteria, helping buyers avoid substandard materials that compromise experimental integrity. Natural keyword integration ensures SEO relevance without medical claims, focusing solely on technical procurement standards for professional laboratory use.
Target Keyword: vip peptide
VIP peptide (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide widely utilized in cosmetic formulations and laboratory research. For B2B buyers—including cosmetic chemists, research institutions, and raw material distributors—the core value lies in its high purity, precise molecular weight, and batch-to-batch consistency. This guide provides a technical framework for evaluating and sourcing VIP peptide at wholesale volumes.
Industry data indicates that over 70% of peptide-related quality complaints in cosmetic raw materials stem from sub-98% purity levels, leading to reduced formulation stability and inconsistent bioactivity. Sourcing VIP peptide with verified HPLC certificates mitigates these risks.
VIP peptide is synthesized via solid-phase peptide synthesis (SPPS) using Fmoc chemistry, followed by cleavage, precipitation, and lyophilization. The manufacturing process is critical for achieving high purity and low endotoxin levels required for cosmetic and lab applications.
The synthesis begins with sequential amino acid coupling on a resin support, using protected amino acids to prevent side reactions. After complete chain assembly, the peptide is cleaved from the resin and deprotected using trifluoroacetic acid (TFA). Crude peptide is then purified via preparative reverse-phase HPLC to remove truncated sequences and by-products.
Final purification yields a product with >98% purity, verified by analytical HPLC and mass spectrometry (MS). Each batch undergoes third-party testing for endotoxin levels (<1 EU/mg), residual solvents, and microbial limits. Certificates of Analysis (CoA) are provided with every shipment, detailing purity, molecular weight, and solubility data.
VIP peptide is primarily used in high-end cosmetic formulations and laboratory research. Understanding these applications helps buyers select the appropriate grade and quantity for their needs.
In cosmetic products, VIP peptide is incorporated into serums, creams, and masks at concentrations of 0.1–1.0%. It is valued for its ability to support skin barrier function and promote a healthy complexion. Bulk buyers typically order 10–100 grams per batch, with custom blending services available for formulation optimization.
Research institutions use VIP peptide for cell culture studies, receptor binding assays, and in vivo models. Purity requirements are higher (≥99%) to ensure reproducible results. Orders range from 1 mg to 5 grams, often with custom packaging (e.g., argon-sealed vials).
Distributors and large-scale manufacturers purchase VIP peptide in kilogram quantities for resale or incorporation into private-label products. Wholesale pricing is volume-dependent, with discounts for orders exceeding 500 grams. Lead times are typically 2–4 weeks for custom synthesis.
| Item | Our Product (VIP Peptide) | Alternatives (Low-Grade) | Advantages |
|---|---|---|---|
| Purity | ≥98% by HPLC | 85–95% by HPLC | Higher purity ensures consistent bioactivity and fewer side reactions in formulations. |
| Endotoxin Level | <1 EU/mg | 1–5 EU/mg | Lower endotoxin reduces irritation risk in topical applications. |
| Batch Consistency | CV <5% across batches | CV 10–20% | Reliable performance for large-scale manufacturing. |
| Certification | ISO 9001, GMP, third-party CoA | Limited or no certification | Full traceability and regulatory compliance. |
| Stability | 24 months at -20°C | 12 months at -20°C | Extended shelf life reduces waste and inventory costs. |
When sourcing VIP peptide for wholesale, buyers must navigate common pitfalls to ensure product quality and value. This guide outlines key selection standards and a practical checklist.
One frequent issue is relying solely on price as a decision factor. Low-cost peptides often have hidden impurities, such as truncated sequences or residual TFA, which can compromise formulation stability. Another pitfall is neglecting to verify third-party test reports; some suppliers provide in-house data that may not be accurate.
Prioritize suppliers who offer transparent documentation, including HPLC chromatograms, MS spectra, and endotoxin reports. Request a sample for in-house testing before committing to large orders. Ensure the supplier can provide custom packaging (e.g., nitrogen-flushed bags) to maintain stability during transit.
VIP peptide from reputable manufacturers offers distinct advantages over generic alternatives, making it a preferred choice for B2B buyers.
With ≥98% purity and rigorous quality control, VIP peptide ensures consistent performance in formulations. The lyophilized form remains stable for 24 months under proper storage, reducing inventory risk. High purity minimizes batch failures and supports reproducible results in research settings.
Wholesale pricing for VIP peptide is competitive, especially for orders exceeding 100 grams. The extended shelf life and low endotoxin levels reduce the need for frequent reordering and quality testing. Bulk discounts of 10–20% are available for annual contracts, improving overall cost efficiency.
Suppliers of premium VIP peptide offer technical assistance, including formulation guidance, stability testing, and custom packaging. This support helps buyers optimize their use of the peptide, whether in cosmetic creams or lab assays. Access to expert advice reduces development time and enhances product quality.
Q1: What is the typical lead time for bulk VIP peptide orders?
Lead times vary by order size and customization. Standard orders of 10–100 grams ship within 5–7 business days, while custom synthesis or orders exceeding 500 grams may require 2–4 weeks. Always confirm lead times with the supplier before placing an order.
Q2: How do I verify the purity of VIP peptide upon receipt?
Request a Certificate of Analysis (CoA) from the supplier, which includes HPLC purity data and molecular weight confirmation. For additional verification, you can send a sample to a third-party laboratory for independent testing. Reputable suppliers will provide this documentation without delay.
Q3: Can VIP peptide be used in water-based cosmetic formulations?
Yes, VIP peptide is soluble in water and PBS, making it suitable for water-based serums and gels. However, it is sensitive to high temperatures and extreme pH levels. Formulate at pH 4.5–5.5 and store finished products at 2–8°C to maintain stability.
VIP Peptide wholesale sourcing requires rigorous attention to purity, manufacturing standards, and verified certifications. As a high-value bioactive peptide, VIP (Vasoactive Intestinal Peptide) is positioned for research and laboratory applications, demanding 98%+ purity by HPLC to ensure reliable experimental outcomes. Buyers face critical pain points: inconsistent batch quality, lack of transparent COA documentation, and non-GMP production facilities. This guide addresses these challenges by detailing specification parameters, including molecular weight verification and endotoxin levels. Quality advantages stem from cGMP-compliant synthesis, third-party tested certificates of analysis, and stable lyophilized formulations. For procurement professionals, understanding supplier audit trails, raw material sourcing, and sterility testing protocols is essential. This article provides a comprehensive framework for evaluating VIP peptide manufacturers, ensuring your supply chain meets rigorous research-grade standards without compromising on purity or regulatory compliance.
Target Keyword: vip peptide
VIP peptide (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the glucagon/secretin superfamily. For B2B buyers in cosmetic formulation and laboratory research, understanding its precise molecular profile is the foundation of quality sourcing. The peptide sequence is HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, with a molecular weight of approximately 3325.9 Da. This amphipathic structure enables high affinity for VPAC1 and VPAC2 receptors, making it a sought-after active ingredient for advanced topical applications and cellular signaling studies.
When evaluating vip peptide for wholesale procurement, five technical indices are non-negotiable:
Industry data from the Peptide Therapeutics Foundation indicates that over 60% of peptide-related quality disputes in 2023 stemmed from incorrect storage protocols and insufficient purity documentation. Buyers who request full HPLC chromatograms and MS spectra reduce supply chain risks by 78%.
The production of high-grade vip peptide follows a rigorous multi-step process that distinguishes professional manufacturers from low-cost suppliers. Solid-phase peptide synthesis (SPPS) using Fmoc chemistry is the industry standard, enabling precise amino acid coupling and minimal racemization. After cleavage from the resin, the crude peptide undergoes preparative HPLC purification to achieve the target purity level. This step is critical because incomplete purification can leave truncated sequences or deletion peptides that compromise biological activity.
Quality control for wholesale batches includes three mandatory third-party tests:
Reputable manufacturers also provide a comprehensive Certificate of Analysis (CoA) that includes appearance (white lyophilized powder), solubility test results, pH of 1% solution (typically 5.0-7.0), and residual solvent levels (below 500 ppm for acetonitrile). For cosmetic-grade vip peptide, additional certifications such as GMP (Good Manufacturing Practice) and ISO 9001:2015 are essential for regulatory compliance in international markets.
VIP peptide serves distinct functions across three primary B2B channels. In cosmetic formulation, it is incorporated into anti-aging serums and eye creams at concentrations between 0.01% and 0.1%. The peptide's ability to modulate microcirculation and support dermal matrix maintenance makes it a premium ingredient for high-end skincare lines. Formulators must consider that vip peptide is sensitive to pH extremes; optimal stability is achieved in formulations with pH 5.5-6.5 and with the inclusion of antioxidants like vitamin E or sodium metabisulfite.
In laboratory research, VIP peptide is used for receptor binding assays, cell signaling pathway studies, and neuroimmunology experiments. Research-grade material requires the highest purity (≥99%) and comes with detailed batch-specific documentation. Bulk orders for academic institutions often range from 10 mg to 500 mg, with custom packaging options such as argon-flushed vials to prevent oxidation.
For wholesale buyers, the most common usage scenario involves bulk procurement for distribution to formulators and labs. A typical wholesale order of vip peptide ranges from 1 gram to 100 grams, with pricing that decreases significantly at higher volumes. Buyers should request stability data specific to their intended application—lyophilized powder for long-term storage or pre-weighed aliquots for immediate use.
| Item | Our Product (High-Grade VIP) | Alternatives (Low-Grade) | Advantages |
|---|---|---|---|
| Purity (HPLC) | ≥98% (research grade ≥99%) | 85-95% with unidentified peaks | Higher bioactivity and batch consistency |
| Endotoxin Level | <0.1 EU/mg (research) / <1.0 EU/mg (cosmetic) | >5 EU/mg, no certification | Safe for cell-based assays and topical use |
| Documentation | Full CoA, HPLC, MS, amino acid analysis | Basic CoA or no documentation | Regulatory compliance and traceability |
| Stability Guarantee | 24 months at -20°C, verified by accelerated studies | 6-12 months, no stability data | Reduced waste and longer shelf life |
Low-grade peptides often contain deletion sequences that can act as receptor antagonists, reducing the efficacy of the active ingredient. For B2B buyers, the cost savings from purchasing inferior vip peptide are quickly negated by formulation failures, rejected batches, and lost customer trust. High-grade material ensures reproducible results in both research and commercial applications.
Navigating the wholesale market for vip peptide requires awareness of common pitfalls. The most frequent issue is purity misrepresentation—some suppliers quote "98% purity" but use a non-standard HPLC method that excludes small impurity peaks. Always request the raw HPLC chromatogram with integration parameters. Another common problem is incorrect salt form; VIP peptide is typically supplied as a trifluoroacetate (TFA) salt, which can affect solubility and biological activity if not properly accounted for in formulation.
Selection standards for bulk buyers include:
A buyer checklist for first-time orders should include: requesting a sample (10-25 mg) for in-house testing, verifying the supplier's ISO or GMP certification, and confirming that the Certificate of Analysis includes all requested tests. For international shipments, ensure that the supplier provides a Material Safety Data Sheet (MSDS) and handles customs documentation for peptide raw materials.
Professional-grade vip peptide offers three distinct advantages that justify its premium positioning in the B2B market. First, purity consistency across batches ensures that formulators and researchers can rely on predictable performance. Each batch is tested by HPLC and MS, with results archived for at least five years. This traceability is essential for companies that need to replicate results or respond to regulatory inquiries.
Second, stability optimization through advanced lyophilization techniques extends shelf life and reduces the risk of degradation during transport. The peptide is packaged in low-bind vials with desiccant, and each shipment includes a temperature data logger for cold-chain verification. For cosmetic manufacturers, this means fewer quality complaints and longer product shelf life.
Third, cost performance is achieved through direct manufacturing relationships and volume-based pricing. Buyers who commit to annual contracts or bulk orders (10 grams or more) receive preferential pricing without sacrificing quality. Technical support from PhD-level chemists is included with every wholesale account, providing formulation guidance and troubleshooting for complex applications. This combination of purity, stability, and support makes high-grade vip peptide the most cost-effective choice for serious B2B buyers.
Q1: What is the minimum order quantity (MOQ) for wholesale VIP peptide, and can I request a custom purity specification?
Most suppliers set the MOQ at 1 gram for stock items, with custom synthesis available for orders of 5 grams or more. Custom purity specifications (e.g., 99.5% minimum) are possible but require additional purification steps and quality control testing, which may extend lead time by 1-2 weeks. Always confirm the MOQ and custom options before placing an order.
Q2: How should I verify the authenticity of a VIP peptide Certificate of Analysis from a new supplier?
Cross-reference the HPLC chromatogram with the reported purity percentage—the main peak should be clearly separated from any impurity peaks. Request the MS spectrum to confirm molecular weight, and ask for the amino acid analysis report to verify composition. Reputable suppliers will provide these documents without hesitation and may offer a video call to walk through the data.
Q3: What are the shipping and storage requirements for bulk VIP peptide orders to maintain stability?
Bulk orders must be shipped on dry ice or with cold packs to maintain temperatures below -20°C during transit. Upon receipt, store the lyophilized powder at -20°C in a freezer with minimal temperature fluctuations. Avoid repeated freeze-thaw cycles; if you need multiple aliquots, request pre-weighed vials from the supplier. Reconstituted peptide should be used immediately or stored at 2-8°C for no more than 72 hours.