VIP Peptide Market 2006: Growth Data, Product Comparisons & Industry Outlook
Executive Summary
Abstract: The 2006 VIP Peptide Market report provides a comprehensive analysis of product composition, focusing on vasoactive intestinal peptide variants and their formulations. Industry outlook highlights steady growth driven by expanding research in neuroprotection and gastrointestinal disorders. Comparative data evaluates efficacy, purity, and stability across leading suppliers. A selection guide offers criteria for sourcing high-quality peptides, while industry knowledge addresses regulatory trends and manufacturing standards. This report serves as a critical resource for researchers and procurement professionals navigating the evolving peptide landscape.
Target Keyword: vip
Core Molecular Specs & Technical Index
The VIP peptide, or Vasoactive Intestinal Peptide, is a 28-amino-acid neuropeptide belonging to the glucagon/secretin superfamily. It functions as a key neurotransmitter and immunomodulator in both the central and peripheral nervous systems. For B2B buyers—including research laboratories, cosmetic formulation scientists, and bulk raw material distributors—the core value of VIP peptide lies in its high specificity for VPAC1 and VPAC2 receptors, enabling targeted studies in neuroprotection, gastrointestinal motility, and anti-inflammatory pathways.
- Molecular Weight: 3325.8 Da (free base), with a precise sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2.
- Purity Grade: ≥98% by HPLC (research grade) and ≥99% (GMP grade for clinical trials).
- Solubility: Soluble in water at 1 mg/mL, with optimal reconstitution in sterile PBS or 0.1% acetic acid for long-term stability.
- Storage Conditions: Lyophilized powder stable at -20°C for 24 months; reconstituted solution must be used within 7 days at 4°C.
- Bioactivity: EC50 of 0.5–2 nM for cAMP activation in CHO cells expressing VPAC1 receptors, validated via functional ELISA.
Industry data from the 2026 VIP Peptide Market report indicates that global demand for high-purity VIP (≥98%) grew by 12.3% year-over-year in 2025, driven by expanded research in Alzheimer’s disease and inflammatory bowel disease. The average price per 10 mg vial for GMP-grade material ranges from $450 to $680, reflecting stringent manufacturing standards.
Manufacturing & Quality Control
VIP peptide production employs solid-phase peptide synthesis (SPPS) using Fmoc chemistry on a Rink amide resin, ensuring C-terminal amidation critical for biological activity. The process includes automated coupling cycles, cleavage with TFA/TIS/H2O (95:2.5:2.5), and global deprotection. Purification via preparative reverse-phase HPLC achieves >98% purity, followed by lyophilization under controlled vacuum conditions.
- Third-Party Testing: Each batch undergoes independent HPLC, mass spectrometry (MALDI-TOF), and amino acid analysis (AAA) by ISO 17025 accredited labs.
- Certification: COA includes peptide content (by UV), endotoxin levels (<0.5 EU/mg), and residual TFA (<1% by weight).
- Stability Data: Accelerated stability studies at 40°C/75% RH show <2% degradation over 6 months for lyophilized product.
Commercial Application Scenarios
In cosmetic formulation, VIP peptide is incorporated into anti-aging serums at 0.05–0.1% concentration, leveraging its vasodilatory properties to enhance microcirculation and reduce periorbital wrinkles. For lab research, it serves as a standard agonist in VPAC receptor binding assays and cAMP quantification studies. Bulk wholesale buyers typically order 100 mg to 1 kg quantities for preclinical trials or large-scale screening programs.
- Cosmetic Use: Formulated with liposomal delivery systems to improve skin penetration; stability requires pH 5.5–6.5 buffers.
- Lab Research: Used in neuroprotection models (e.g., SH-SY5Y cells) at 10–100 nM concentrations for 24-hour treatments.
- Bulk Wholesale: Custom packaging in argon-flushed vials with desiccant; lead time 14–21 days for orders >500 mg.
vip peptide VS Ordinary Low-Grade Peptides
| Item | Our Product (VIP Peptide) | Alternatives (Low-Grade Peptides) | Advantages |
|---|---|---|---|
| Purity | ≥98% (HPLC) | 85–92% (HPLC) | Higher purity reduces non-specific binding in assays |
| Stability | Lyophilized, stable 24 months at -20°C | Often degraded after 6 months at -20°C | Longer shelf life reduces waste and reordering costs |
| Endotoxin | <0.5 EU/mg | 1–5 EU/mg | Safe for cell culture and in vivo studies |
| Bioactivity | EC50 0.5–2 nM (cAMP assay) | EC50 5–20 nM (cAMP assay) | Higher potency requires lower doses for experiments |
Bulk Purchase Selection Guide
Common pitfalls when sourcing VIP peptide include accepting low-purity material (≤95%) that leads to inconsistent bioassay results, and neglecting to verify endotoxin levels for cell-based work. Selection standards require reviewing the COA for peptide content (should be 85–95% by weight) and requesting a stability report for long-term storage. A buyer checklist should include: (1) confirm HPLC chromatogram shows single peak at retention time 12–14 min, (2) verify mass spec matches theoretical mass of 3325.8 Da, (3) request batch-specific bioactivity data, (4) check storage conditions match your facility capabilities, and (5) evaluate supplier lead time and minimum order quantities.
Core Product Advantages
Our VIP peptide offers purity ≥98% verified by HPLC and MALDI-TOF, ensuring reliable receptor activation in every experiment. Stability is guaranteed through lyophilization with trehalose excipient, maintaining >95% integrity after 12 months at -20°C. Cost performance is optimized via direct manufacturing, providing 15–20% lower pricing than competitors for equivalent GMP-grade material. Technical support includes free reconstitution protocols, custom packaging options, and expedited shipping for urgent research needs.
Frequently Asked Questions
Q1: What is the recommended storage condition for reconstituted VIP peptide?
Reconstituted VIP peptide should be stored at 4°C and used within 7 days. For longer storage, aliquot and freeze at -20°C for up to 3 months, avoiding repeated freeze-thaw cycles.
Q2: How do I verify the purity of VIP peptide upon receipt?
Request the COA with HPLC chromatogram showing a single peak at >98% area. Optionally, run a MALDI-TOF mass spec to confirm the molecular weight of 3325.8 Da.
Q3: Can VIP peptide be used in cosmetic formulations with other active ingredients?
Yes, but compatibility testing is recommended. Avoid formulations with high concentrations of ethanol (>10%) or strong acids (pH <4.0) that may degrade the peptide. Use liposomal encapsulation for enhanced stability.