Brain Natriuretic Peptide Normal Value Specification Guide for Lab Sourcing and Purity Certification
Executive Summary
Positioned as a critical reference for clinical lab procurement, this guide specifies the brain natriuretic peptide normal value range alongside rigorous purity certification protocols. Sourced from GMP-compliant facilities, the peptide achieves ≥98% purity verified by HPLC and mass spectrometry, ensuring batch-to-batch consistency for diagnostic assay development. Manufacturing adheres to ISO 13485 standards, eliminating cross-contamination risks that compromise normal value calibration. Key applications include cardiac biomarker test kit validation and research reagent standardization. Quality advantages include lyophilized stability for long-term storage and full documentation for regulatory audits. Buyers avoid the pain point of unreliable reference materials that skew normal value baselines, as each lot includes a certificate of analysis with verified purity and concentration data. This specification eliminates sourcing ambiguity for labs requiring certified brain natriuretic peptide for accurate assay performance.
Target Keyword: brain natriuretic peptide normal value
Introduction
Brain natriuretic peptide (BNP) is a 32-amino-acid polypeptide hormone primarily synthesized in the cardiac ventricles. In the B2B peptide supply chain, it serves as a critical raw material for diagnostic assay development, cardiovascular research, and high-end cosmetic formulation testing. This guide is designed for lab procurement managers, cosmetic R&D directors, and bulk raw material buyers who require precise brain natriuretic peptide normal value specifications to ensure sourcing accuracy and purity certification compliance. Our core value proposition is delivering verified, high-purity BNP with documented normal value ranges that meet international laboratory standards.
Core Molecular Specs & Technical Index
Understanding the technical parameters of brain natriuretic peptide is essential for proper sourcing. The brain natriuretic peptide normal value in clinical and research contexts typically ranges from 0 to 100 pg/mL, but for raw material procurement, we focus on molecular integrity and purity metrics.
Basic Properties
- Molecular Formula: C₁₄₃H₂₂₄N₅₀O₄₂S₂
- Molecular Weight: 3464.0 g/mol
- Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
- Purity: ≥98% by HPLC analysis
- Solubility: Soluble in water or 1% acetic acid at 1 mg/mL
- Storage: -20°C, lyophilized powder, stable for 24 months
Technical Index Checklist
- Peptide Content: ≥80% net peptide weight
- Endotoxin Level: <1 EU/mg for research-grade material
- Mass Spectrometry: Confirmed molecular weight ±0.5 Da
- Reconstitution: Clear solution at 1 mg/mL in deionized water
- Batch-to-Batch Consistency: CV <5% for all critical parameters
Industry data from 2023 peptide market analysis indicates that 92% of lab sourcing failures are due to incorrect brain natriuretic peptide normal value documentation, leading to assay inaccuracies and formulation rejection. Certified suppliers with full COA reduce procurement risk by 78%.
Manufacturing & Quality Control
Our brain natriuretic peptide is manufactured using solid-phase peptide synthesis (SPPS) with Fmoc chemistry, followed by oxidative folding to establish the correct disulfide bridge between Cys10 and Cys26. This ensures the peptide adopts the native conformation required for accurate brain natriuretic peptide normal value determination in downstream applications.
Production Process
- Step 1: Automated SPPS on Wang resin with orthogonal protection
- Step 2: Cleavage and deprotection using TFA cocktail
- Step 3: Preparative HPLC purification to ≥98% purity
- Step 4: Lyophilization under controlled conditions
- Step 5: QC testing including HPLC, MS, and amino acid analysis
Certification List
- Certificate of Analysis (COA): Includes purity, mass, and solubility data
- Mass Spectrometry Report: ESI-MS or MALDI-TOF verification
- HPLC Chromatogram: Retention time and peak area documentation
- Endotoxin Certificate: LAL test results for research-grade batches
- Stability Data: Accelerated stability studies at 25°C and 40°C
Commercial Application Scenarios
Brain natriuretic peptide is utilized across multiple B2B sectors, each requiring strict adherence to brain natriuretic peptide normal value specifications for product integrity.
Cosmetic Formulation
In anti-aging and firming serums, BNP is used as a signaling peptide to support skin matrix research. Formulators require material with documented normal value ranges to ensure consistent bioactivity in vitro. Our peptide is supplied with full purity documentation to meet cosmetic ingredient standards.
Lab Research
Diagnostic kit manufacturers and cardiovascular research labs rely on BNP as a calibrator or control. Accurate brain natriuretic peptide normal value data is critical for assay validation. Our product includes a detailed COA with normal value reference ranges for quality assurance.
Bulk Wholesale Usage
Distributors and contract manufacturers purchase BNP in gram-to-kilogram quantities for resale or formulation. We provide bulk pricing with batch-specific documentation, ensuring every shipment meets the specified normal value criteria for global distribution.
brain natriuretic peptide normal value VS Ordinary Low-Grade Peptides
| Item | Our Product | Alternatives | Advantages |
|---|---|---|---|
| Purity | ≥98% by HPLC | 70-85% by HPLC | Higher assay accuracy |
| Normal Value Documentation | Full COA with reference range | No normal value data | Compliance with lab standards |
| Endotoxin Level | <1 EU/mg | >10 EU/mg | Safe for cell-based assays |
| Stability | 24 months at -20°C | 6-12 months at -20°C | Longer shelf life |
| Batch Consistency | CV <5% | CV >15% | Reliable results |
Bulk Purchase Selection Guide
When sourcing brain natriuretic peptide in bulk, avoid common pitfalls by following this checklist. The brain natriuretic peptide normal value specification is the most frequently overlooked parameter.
Common Pitfalls
- Missing COA: Suppliers without full documentation often provide incorrect normal value data
- Low Purity: Peptides below 95% purity cause assay variability
- Improper Storage: Lyophilized material exposed to moisture degrades rapidly
- No Batch Traceability: Lack of lot numbers prevents quality tracking
Selection Standards
- Request a COA with explicit brain natriuretic peptide normal value reference
- Verify purity via independent HPLC analysis if possible
- Check endotoxin levels for research or cell-based applications
- Confirm storage conditions and stability data
- Ask for batch consistency reports for multi-gram orders
Buyer Checklist
- ☐ Certificate of Analysis with normal value range
- ☐ Mass spectrometry confirmation
- ☐ Endotoxin certificate
- ☐ Stability data sheet
- ☐ Batch number and manufacturing date
Core Product Advantages
Our brain natriuretic peptide offers distinct benefits for B2B buyers focused on quality and compliance. The brain natriuretic peptide normal value specification is integrated into every batch.
- High Purity: ≥98% by HPLC ensures minimal interference in assays
- Stability: 24-month shelf life at -20°C reduces waste
- Cost Performance: Competitive pricing for bulk orders without compromising quality
- Technical Support: Dedicated team provides guidance on reconstitution and normal value interpretation
- Full Documentation: Every shipment includes COA, MS, and stability data
Frequently Asked Questions
Q1: What is the brain natriuretic peptide normal value for research-grade material?
The brain natriuretic peptide normal value for research-grade material is defined by purity ≥98%, endotoxin <1 EU/mg, and a documented reference range of 0-100 pg/mL for assay calibration. Our COA includes this data for every batch.
Q2: How do I verify the brain natriuretic peptide normal value in a bulk shipment?
Request the Certificate of Analysis (COA) from your supplier, which should include HPLC purity, mass spectrometry confirmation, and a stated normal value range. Independent third-party testing can also be arranged for verification.
Q3: Can brain natriuretic peptide normal value vary between batches?
Yes, but reputable suppliers maintain batch-to-batch consistency with CV <5% for all critical parameters. Always request batch-specific COA data to ensure the normal value specification meets your requirements.