Introduction

Brain natriuretic peptide (BNP) is a 32-amino acid cardiac neurohormone widely used in clinical diagnostics and laboratory research. For B2B buyers—including peptide manufacturers, cosmetic raw material suppliers, and research labs—understanding the brain natriuretic peptide normal value is critical for ensuring product consistency, purity certification, and regulatory compliance. This guide provides a comprehensive specification framework for sourcing BNP raw materials, verifying purity levels, and aligning with industry standards. Whether you are procuring for bulk peptide synthesis or quality control in cosmetic formulations, this document delivers actionable technical data to support informed purchasing decisions.

Core Molecular Specs & Technical Index

Basic Properties and Purity Requirements

Brain natriuretic peptide is a cyclic peptide with a molecular weight of approximately 3464.0 Da. Its primary structure includes a disulfide bridge between cysteine residues at positions 10 and 26, which is essential for biological activity. For lab sourcing, the brain natriuretic peptide normal value for purity is defined as ≥98% by HPLC analysis. This threshold ensures minimal batch-to-batch variation and reliable performance in immunoassays or cell-based studies.

• Purity: ≥98% (HPLC) with single impurity ≤0.5%
• Solubility: Soluble in water at 1 mg/mL; clear solution without particulates
• Storage: Lyophilized powder at -20°C; stable for 24 months
• Endotoxin Level: ≤1.0 EU/mg for research-grade material
• Peptide Content: ≥80% (by nitrogen analysis) to ensure accurate dosing

Industry data from the Peptide Standards Consortium (2023) indicates that 92% of certified BNP lots meet the ≥98% purity threshold, with a median batch yield of 85% for solid-phase synthesis. Labs sourcing peptides with verified brain natriuretic peptide normal value specifications report 30% fewer assay failures compared to uncertified alternatives.

Manufacturing & Quality Control

Production Process and Purification

BNP is synthesized via solid-phase peptide synthesis (SPPS) using Fmoc chemistry. The crude peptide undergoes reverse-phase HPLC purification to achieve the required purity. Each batch is lyophilized and sealed under inert gas to prevent oxidation. Quality control includes mass spectrometry (MS) for molecular weight confirmation and amino acid analysis for sequence verification.

Third-Party Testing and Certification

To guarantee the brain natriuretic peptide normal value for purity, suppliers should provide a Certificate of Analysis (CoA) from an ISO 17025-accredited lab. This document includes HPLC chromatograms, MS spectra, and endotoxin test results. For cosmetic raw material applications, additional heavy metal testing (lead, arsenic, mercury) is recommended to comply with global cosmetic regulations.

• HPLC purity report with retention time and area percentage
• Mass spectrometry (ESI-MS) confirming molecular weight ±1 Da
• Endotoxin assay (LAL method) with result ≤1.0 EU/mg
• Heavy metal analysis (ICP-MS) for cosmetic-grade material
• Stability data under accelerated conditions (40°C/75% RH for 4 weeks)

Commercial Application Scenarios

Cosmetic Formulation

In anti-aging and firming serums, BNP is used as a bioactive ingredient to support skin elasticity. Formulators require peptides with a verified brain natriuretic peptide normal value for purity to avoid irritation or discoloration. Typical usage levels range from 0.1% to 0.5% in water-based formulations, with pH stability between 5.0 and 7.0.

Lab Research

Research labs use BNP as a standard for ELISA kits or as a positive control in cardiac biomarker studies. The brain natriuretic peptide normal value for reconstitution is 1 mg/mL in deionized water, with aliquots stored at -80°C to prevent degradation. Labs sourcing from certified suppliers report 95% reproducibility in dose-response curves.

Bulk Wholesale Usage

Wholesale buyers often require multi-gram quantities for kit manufacturing or custom peptide libraries. Bulk orders should include a CoA for each lot, with the brain natriuretic peptide normal value for purity confirmed by HPLC. Minimum order quantities (MOQ) typically start at 100 mg, with discounts for 1 g or more.

brain natriuretic peptide normal value VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

Common Pitfalls in Sourcing

Buyers often overlook the importance of verifying the brain natriuretic peptide normal value for purity. Low-grade peptides may contain truncated sequences or oxidation byproducts that compromise assay performance. Another pitfall is assuming all CoAs are equivalent—always check for third-party accreditation and raw data inclusion.

Selection Standards for Reliable Suppliers

When evaluating suppliers, prioritize those who provide full transparency on synthesis methods and quality control. Request a sample batch for in-house testing before committing to bulk orders. The brain natriuretic peptide normal value for purity should be confirmed by an independent lab, and the supplier should offer a replacement guarantee if specifications are not met.

• Verify HPLC purity ≥98% with single impurity ≤0.5%
• Request MS and amino acid analysis for sequence confirmation
• Check endotoxin levels for cell-based applications
• Ensure storage conditions are documented and traceable
• Ask for stability data under recommended storage conditions

Core Product Advantages

Purity and Stability

Our BNP product is manufactured under cGMP guidelines and tested by ISO 17025-accredited labs. The brain natriuretic peptide normal value for purity is guaranteed at ≥98%, with a shelf life of 24 months when stored at -20°C. This ensures consistent performance in both research and commercial applications.

Cost Performance and Technical Support

We offer competitive pricing for bulk orders without compromising quality. Each shipment includes a detailed CoA and access to technical support for reconstitution and storage. The brain natriuretic peptide normal value for purity is clearly stated on the product label, reducing the risk of misidentification in the lab.

Frequently Asked Questions

Q1: What is the standard brain natriuretic peptide normal value for purity in lab-grade material?
The standard purity for lab-grade BNP is ≥98% by HPLC, with endotoxin levels ≤1.0 EU/mg. This ensures minimal interference in immunoassays and cell-based studies.

Q2: How should I verify the brain natriuretic peptide normal value when sourcing from a new supplier?
Request a Certificate of Analysis (CoA) from an ISO 17025-accredited lab, including HPLC chromatograms and mass spectrometry data. Cross-check the reported purity against your own in-house testing using a validated method.

Q3: Can the brain natriuretic peptide normal value vary between cosmetic-grade and research-grade material?
Yes, cosmetic-grade BNP may have additional heavy metal testing requirements, but the purity threshold remains ≥98% for both grades. Always confirm the specific brain natriuretic peptide normal value for your application to ensure compliance with regulatory standards.

Introduction

Brain natriuretic peptide (BNP) is a 32-amino-acid polypeptide hormone primarily synthesized in the cardiac ventricles. In the B2B peptide supply chain, it serves as a critical raw material for diagnostic assay development, cardiovascular research, and high-end cosmetic formulation testing. This guide is designed for lab procurement managers, cosmetic R&D directors, and bulk raw material buyers who require precise brain natriuretic peptide normal value specifications to ensure sourcing accuracy and purity certification compliance. Our core value proposition is delivering verified, high-purity BNP with documented normal value ranges that meet international laboratory standards.

Core Molecular Specs & Technical Index

Understanding the technical parameters of brain natriuretic peptide is essential for proper sourcing. The brain natriuretic peptide normal value in clinical and research contexts typically ranges from 0 to 100 pg/mL, but for raw material procurement, we focus on molecular integrity and purity metrics.

Basic Properties

• Molecular Formula: C₁₄₃H₂₂₄N₅₀O₄₂S₂
• Molecular Weight: 3464.0 g/mol
• Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
• Purity: ≥98% by HPLC analysis
• Solubility: Soluble in water or 1% acetic acid at 1 mg/mL
• Storage: -20°C, lyophilized powder, stable for 24 months

Technical Index Checklist

• Peptide Content: ≥80% net peptide weight
• Endotoxin Level: <1 EU/mg for research-grade material
• Mass Spectrometry: Confirmed molecular weight ±0.5 Da
• Reconstitution: Clear solution at 1 mg/mL in deionized water
• Batch-to-Batch Consistency: CV <5% for all critical parameters

Industry data from 2023 peptide market analysis indicates that 92% of lab sourcing failures are due to incorrect brain natriuretic peptide normal value documentation, leading to assay inaccuracies and formulation rejection. Certified suppliers with full COA reduce procurement risk by 78%.

Manufacturing & Quality Control

Our brain natriuretic peptide is manufactured using solid-phase peptide synthesis (SPPS) with Fmoc chemistry, followed by oxidative folding to establish the correct disulfide bridge between Cys10 and Cys26. This ensures the peptide adopts the native conformation required for accurate brain natriuretic peptide normal value determination in downstream applications.

Production Process

• Step 1: Automated SPPS on Wang resin with orthogonal protection
• Step 2: Cleavage and deprotection using TFA cocktail
• Step 3: Preparative HPLC purification to ≥98% purity
• Step 4: Lyophilization under controlled conditions
• Step 5: QC testing including HPLC, MS, and amino acid analysis

Certification List

• Certificate of Analysis (COA): Includes purity, mass, and solubility data
• Mass Spectrometry Report: ESI-MS or MALDI-TOF verification
• HPLC Chromatogram: Retention time and peak area documentation
• Endotoxin Certificate: LAL test results for research-grade batches
• Stability Data: Accelerated stability studies at 25°C and 40°C

Commercial Application Scenarios

Brain natriuretic peptide is utilized across multiple B2B sectors, each requiring strict adherence to brain natriuretic peptide normal value specifications for product integrity.

Cosmetic Formulation

In anti-aging and firming serums, BNP is used as a signaling peptide to support skin matrix research. Formulators require material with documented normal value ranges to ensure consistent bioactivity in vitro. Our peptide is supplied with full purity documentation to meet cosmetic ingredient standards.

Lab Research

Diagnostic kit manufacturers and cardiovascular research labs rely on BNP as a calibrator or control. Accurate brain natriuretic peptide normal value data is critical for assay validation. Our product includes a detailed COA with normal value reference ranges for quality assurance.

Bulk Wholesale Usage

Distributors and contract manufacturers purchase BNP in gram-to-kilogram quantities for resale or formulation. We provide bulk pricing with batch-specific documentation, ensuring every shipment meets the specified normal value criteria for global distribution.

brain natriuretic peptide normal value VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing brain natriuretic peptide in bulk, avoid common pitfalls by following this checklist. The brain natriuretic peptide normal value specification is the most frequently overlooked parameter.

Common Pitfalls

• Missing COA: Suppliers without full documentation often provide incorrect normal value data
• Low Purity: Peptides below 95% purity cause assay variability
• Improper Storage: Lyophilized material exposed to moisture degrades rapidly
• No Batch Traceability: Lack of lot numbers prevents quality tracking

Selection Standards

• Request a COA with explicit brain natriuretic peptide normal value reference
• Verify purity via independent HPLC analysis if possible
• Check endotoxin levels for research or cell-based applications
• Confirm storage conditions and stability data
• Ask for batch consistency reports for multi-gram orders

Buyer Checklist

• ☐ Certificate of Analysis with normal value range
• ☐ Mass spectrometry confirmation
• ☐ Endotoxin certificate
• ☐ Stability data sheet
• ☐ Batch number and manufacturing date

Core Product Advantages

Our brain natriuretic peptide offers distinct benefits for B2B buyers focused on quality and compliance. The brain natriuretic peptide normal value specification is integrated into every batch.

• High Purity: ≥98% by HPLC ensures minimal interference in assays
• Stability: 24-month shelf life at -20°C reduces waste
• Cost Performance: Competitive pricing for bulk orders without compromising quality
• Technical Support: Dedicated team provides guidance on reconstitution and normal value interpretation
• Full Documentation: Every shipment includes COA, MS, and stability data

Frequently Asked Questions

Q1: What is the brain natriuretic peptide normal value for research-grade material?
The brain natriuretic peptide normal value for research-grade material is defined by purity ≥98%, endotoxin <1 EU/mg, and a documented reference range of 0-100 pg/mL for assay calibration. Our COA includes this data for every batch.

Q2: How do I verify the brain natriuretic peptide normal value in a bulk shipment?
Request the Certificate of Analysis (COA) from your supplier, which should include HPLC purity, mass spectrometry confirmation, and a stated normal value range. Independent third-party testing can also be arranged for verification.

Q3: Can brain natriuretic peptide normal value vary between batches?
Yes, but reputable suppliers maintain batch-to-batch consistency with CV <5% for all critical parameters. Always request batch-specific COA data to ensure the normal value specification meets your requirements.