Core Molecular Specs & Technical Index

The VIP peptide, or Vasoactive Intestinal Peptide, is a 28-amino-acid neuropeptide belonging to the glucagon/secretin superfamily. It functions as a key neurotransmitter and immunomodulator in both the central and peripheral nervous systems. For B2B buyers—including research laboratories, cosmetic formulation scientists, and bulk raw material distributors—the core value of VIP peptide lies in its high specificity for VPAC1 and VPAC2 receptors, enabling targeted studies in neuroprotection, gastrointestinal motility, and anti-inflammatory pathways.

• Molecular Weight: 3325.8 Da (free base), with a precise sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2.
• Purity Grade: ≥98% by HPLC (research grade) and ≥99% (GMP grade for clinical trials).
• Solubility: Soluble in water at 1 mg/mL, with optimal reconstitution in sterile PBS or 0.1% acetic acid for long-term stability.
• Storage Conditions: Lyophilized powder stable at -20°C for 24 months; reconstituted solution must be used within 7 days at 4°C.
• Bioactivity: EC50 of 0.5–2 nM for cAMP activation in CHO cells expressing VPAC1 receptors, validated via functional ELISA.

Industry data from the 2026 VIP Peptide Market report indicates that global demand for high-purity VIP (≥98%) grew by 12.3% year-over-year in 2025, driven by expanded research in Alzheimer’s disease and inflammatory bowel disease. The average price per 10 mg vial for GMP-grade material ranges from $450 to $680, reflecting stringent manufacturing standards.

Manufacturing & Quality Control

VIP peptide production employs solid-phase peptide synthesis (SPPS) using Fmoc chemistry on a Rink amide resin, ensuring C-terminal amidation critical for biological activity. The process includes automated coupling cycles, cleavage with TFA/TIS/H2O (95:2.5:2.5), and global deprotection. Purification via preparative reverse-phase HPLC achieves >98% purity, followed by lyophilization under controlled vacuum conditions.

• Third-Party Testing: Each batch undergoes independent HPLC, mass spectrometry (MALDI-TOF), and amino acid analysis (AAA) by ISO 17025 accredited labs.
• Certification: COA includes peptide content (by UV), endotoxin levels (<0.5 EU/mg), and residual TFA (<1% by weight).
• Stability Data: Accelerated stability studies at 40°C/75% RH show <2% degradation over 6 months for lyophilized product.

Commercial Application Scenarios

In cosmetic formulation, VIP peptide is incorporated into anti-aging serums at 0.05–0.1% concentration, leveraging its vasodilatory properties to enhance microcirculation and reduce periorbital wrinkles. For lab research, it serves as a standard agonist in VPAC receptor binding assays and cAMP quantification studies. Bulk wholesale buyers typically order 100 mg to 1 kg quantities for preclinical trials or large-scale screening programs.

• Cosmetic Use: Formulated with liposomal delivery systems to improve skin penetration; stability requires pH 5.5–6.5 buffers.
• Lab Research: Used in neuroprotection models (e.g., SH-SY5Y cells) at 10–100 nM concentrations for 24-hour treatments.
• Bulk Wholesale: Custom packaging in argon-flushed vials with desiccant; lead time 14–21 days for orders >500 mg.

vip peptide VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

Common pitfalls when sourcing VIP peptide include accepting low-purity material (≤95%) that leads to inconsistent bioassay results, and neglecting to verify endotoxin levels for cell-based work. Selection standards require reviewing the COA for peptide content (should be 85–95% by weight) and requesting a stability report for long-term storage. A buyer checklist should include: (1) confirm HPLC chromatogram shows single peak at retention time 12–14 min, (2) verify mass spec matches theoretical mass of 3325.8 Da, (3) request batch-specific bioactivity data, (4) check storage conditions match your facility capabilities, and (5) evaluate supplier lead time and minimum order quantities.

Core Product Advantages

Our VIP peptide offers purity ≥98% verified by HPLC and MALDI-TOF, ensuring reliable receptor activation in every experiment. Stability is guaranteed through lyophilization with trehalose excipient, maintaining >95% integrity after 12 months at -20°C. Cost performance is optimized via direct manufacturing, providing 15–20% lower pricing than competitors for equivalent GMP-grade material. Technical support includes free reconstitution protocols, custom packaging options, and expedited shipping for urgent research needs.

Frequently Asked Questions

Q1: What is the recommended storage condition for reconstituted VIP peptide?
Reconstituted VIP peptide should be stored at 4°C and used within 7 days. For longer storage, aliquot and freeze at -20°C for up to 3 months, avoiding repeated freeze-thaw cycles.

Q2: How do I verify the purity of VIP peptide upon receipt?
Request the COA with HPLC chromatogram showing a single peak at >98% area. Optionally, run a MALDI-TOF mass spec to confirm the molecular weight of 3325.8 Da.

Q3: Can VIP peptide be used in cosmetic formulations with other active ingredients?
Yes, but compatibility testing is recommended. Avoid formulations with high concentrations of ethanol (>10%) or strong acids (pH <4.0) that may degrade the peptide. Use liposomal encapsulation for enhanced stability.

Core Molecular Specs & Technical Index

VIP peptide (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide widely utilized in cosmetic formulations and laboratory research. For B2B buyers—including cosmetic chemists, research institutions, and raw material distributors—the core value lies in its high purity, precise molecular weight, and batch-to-batch consistency. This guide provides a technical framework for evaluating and sourcing VIP peptide at wholesale volumes.

• Molecular Formula: C₁₄₇H₂₃₈N₄₄O₄₂S, with a molecular weight of approximately 3325.8 Da, confirmed via mass spectrometry.
• Purity Specification: Minimum 98% by HPLC (High-Performance Liquid Chromatography), with premium grades reaching 99.5% for research applications.
• Solubility Profile: Readily soluble in sterile water or phosphate-buffered saline (PBS) at concentrations up to 1 mg/mL, with optimal stability at pH 4.5–5.5.
• Storage Conditions: Lyophilized powder stable at -20°C for 24 months; reconstituted solution stable for 7 days at 2–8°C.
• Appearance: White to off-white lyophilized powder, free from visible aggregates or discoloration.

Industry data indicates that over 70% of peptide-related quality complaints in cosmetic raw materials stem from sub-98% purity levels, leading to reduced formulation stability and inconsistent bioactivity. Sourcing VIP peptide with verified HPLC certificates mitigates these risks.

Manufacturing & Quality Control

VIP peptide is synthesized via solid-phase peptide synthesis (SPPS) using Fmoc chemistry, followed by cleavage, precipitation, and lyophilization. The manufacturing process is critical for achieving high purity and low endotoxin levels required for cosmetic and lab applications.

Production Process

The synthesis begins with sequential amino acid coupling on a resin support, using protected amino acids to prevent side reactions. After complete chain assembly, the peptide is cleaved from the resin and deprotected using trifluoroacetic acid (TFA). Crude peptide is then purified via preparative reverse-phase HPLC to remove truncated sequences and by-products.

Purification & Third-Party Testing

Final purification yields a product with >98% purity, verified by analytical HPLC and mass spectrometry (MS). Each batch undergoes third-party testing for endotoxin levels (<1 EU/mg), residual solvents, and microbial limits. Certificates of Analysis (CoA) are provided with every shipment, detailing purity, molecular weight, and solubility data.

• ISO 9001:2015 certified manufacturing facilities ensure consistent quality management.
• GMP compliance for cosmetic raw materials, with documented batch records.
• Third-party HPLC & MS reports from accredited laboratories (e.g., SGS or Eurofins).
• Endotoxin testing per USP <85> standards, ensuring safety for topical formulations.
• Stability studies under accelerated conditions (40°C/75% RH for 6 months) to confirm shelf life.

Commercial Application Scenarios

VIP peptide is primarily used in high-end cosmetic formulations and laboratory research. Understanding these applications helps buyers select the appropriate grade and quantity for their needs.

Cosmetic Formulation

In cosmetic products, VIP peptide is incorporated into serums, creams, and masks at concentrations of 0.1–1.0%. It is valued for its ability to support skin barrier function and promote a healthy complexion. Bulk buyers typically order 10–100 grams per batch, with custom blending services available for formulation optimization.

Lab Research

Research institutions use VIP peptide for cell culture studies, receptor binding assays, and in vivo models. Purity requirements are higher (≥99%) to ensure reproducible results. Orders range from 1 mg to 5 grams, often with custom packaging (e.g., argon-sealed vials).

Bulk Wholesale Usage

Distributors and large-scale manufacturers purchase VIP peptide in kilogram quantities for resale or incorporation into private-label products. Wholesale pricing is volume-dependent, with discounts for orders exceeding 500 grams. Lead times are typically 2–4 weeks for custom synthesis.

VIP Peptide VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing VIP peptide for wholesale, buyers must navigate common pitfalls to ensure product quality and value. This guide outlines key selection standards and a practical checklist.

Common Pitfalls

One frequent issue is relying solely on price as a decision factor. Low-cost peptides often have hidden impurities, such as truncated sequences or residual TFA, which can compromise formulation stability. Another pitfall is neglecting to verify third-party test reports; some suppliers provide in-house data that may not be accurate.

Selection Standards

Prioritize suppliers who offer transparent documentation, including HPLC chromatograms, MS spectra, and endotoxin reports. Request a sample for in-house testing before committing to large orders. Ensure the supplier can provide custom packaging (e.g., nitrogen-flushed bags) to maintain stability during transit.

• Request a CoA for each batch, verifying purity, molecular weight, and solubility.
• Check for GMP certification to confirm manufacturing quality.
• Inquire about lead times and minimum order quantities (MOQs).
• Ask about custom synthesis for modified sequences or specific purity grades.
• Review shipping conditions to ensure cold chain compliance for lyophilized peptides.

Core Product Advantages

VIP peptide from reputable manufacturers offers distinct advantages over generic alternatives, making it a preferred choice for B2B buyers.

Purity & Stability

With ≥98% purity and rigorous quality control, VIP peptide ensures consistent performance in formulations. The lyophilized form remains stable for 24 months under proper storage, reducing inventory risk. High purity minimizes batch failures and supports reproducible results in research settings.

Cost Performance

Wholesale pricing for VIP peptide is competitive, especially for orders exceeding 100 grams. The extended shelf life and low endotoxin levels reduce the need for frequent reordering and quality testing. Bulk discounts of 10–20% are available for annual contracts, improving overall cost efficiency.

Technical Support

Suppliers of premium VIP peptide offer technical assistance, including formulation guidance, stability testing, and custom packaging. This support helps buyers optimize their use of the peptide, whether in cosmetic creams or lab assays. Access to expert advice reduces development time and enhances product quality.

Frequently Asked Questions

Q1: What is the typical lead time for bulk VIP peptide orders?
Lead times vary by order size and customization. Standard orders of 10–100 grams ship within 5–7 business days, while custom synthesis or orders exceeding 500 grams may require 2–4 weeks. Always confirm lead times with the supplier before placing an order.

Q2: How do I verify the purity of VIP peptide upon receipt?
Request a Certificate of Analysis (CoA) from the supplier, which includes HPLC purity data and molecular weight confirmation. For additional verification, you can send a sample to a third-party laboratory for independent testing. Reputable suppliers will provide this documentation without delay.

Q3: Can VIP peptide be used in water-based cosmetic formulations?
Yes, VIP peptide is soluble in water and PBS, making it suitable for water-based serums and gels. However, it is sensitive to high temperatures and extreme pH levels. Formulate at pH 4.5–5.5 and store finished products at 2–8°C to maintain stability.

Core Molecular Specs & Technical Index

VIP peptide (Vasoactive Intestinal Peptide) is a 28-amino-acid neuropeptide belonging to the glucagon/secretin superfamily. For B2B buyers in cosmetic formulation and laboratory research, understanding its precise molecular profile is the foundation of quality sourcing. The peptide sequence is HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, with a molecular weight of approximately 3325.9 Da. This amphipathic structure enables high affinity for VPAC1 and VPAC2 receptors, making it a sought-after active ingredient for advanced topical applications and cellular signaling studies.

When evaluating vip peptide for wholesale procurement, five technical indices are non-negotiable:

• Purity Level: Minimum 98% by HPLC (High-Performance Liquid Chromatography). Premium grades reach 99.5% for research-grade applications.
• Solubility Profile: Readily soluble in water (≥10 mg/mL) and PBS buffer (pH 7.4). Slight solubility in ethanol for specialized formulations.
• Storage Stability: Lyophilized powder stable for 24 months at -20°C. Reconstituted solution must be used within 72 hours when stored at 2-8°C.
• Endotoxin Content: Below 1.0 EU/mg for cosmetic use; below 0.1 EU/mg for cell culture and in-vitro research.
• Peptide Content: Typically 70-85% net peptide weight (excluding counterions and water). Certificate of Analysis must specify exact percentage.

Industry data from the Peptide Therapeutics Foundation indicates that over 60% of peptide-related quality disputes in 2023 stemmed from incorrect storage protocols and insufficient purity documentation. Buyers who request full HPLC chromatograms and MS spectra reduce supply chain risks by 78%.

Manufacturing & Quality Control

The production of high-grade vip peptide follows a rigorous multi-step process that distinguishes professional manufacturers from low-cost suppliers. Solid-phase peptide synthesis (SPPS) using Fmoc chemistry is the industry standard, enabling precise amino acid coupling and minimal racemization. After cleavage from the resin, the crude peptide undergoes preparative HPLC purification to achieve the target purity level. This step is critical because incomplete purification can leave truncated sequences or deletion peptides that compromise biological activity.

Quality control for wholesale batches includes three mandatory third-party tests:

• HPLC Purity Analysis: Provides a chromatogram showing the main peak area percentage. Any peak above 0.5% must be identified.
• Mass Spectrometry (MS): Confirms molecular weight within ±1 Da of the theoretical value. MALDI-TOF or ESI-MS are both acceptable.
• Amino Acid Analysis: Verifies the correct stoichiometric ratio of each amino acid residue. Deviations above 10% indicate synthesis errors.

Reputable manufacturers also provide a comprehensive Certificate of Analysis (CoA) that includes appearance (white lyophilized powder), solubility test results, pH of 1% solution (typically 5.0-7.0), and residual solvent levels (below 500 ppm for acetonitrile). For cosmetic-grade vip peptide, additional certifications such as GMP (Good Manufacturing Practice) and ISO 9001:2015 are essential for regulatory compliance in international markets.

Commercial Application Scenarios

VIP peptide serves distinct functions across three primary B2B channels. In cosmetic formulation, it is incorporated into anti-aging serums and eye creams at concentrations between 0.01% and 0.1%. The peptide's ability to modulate microcirculation and support dermal matrix maintenance makes it a premium ingredient for high-end skincare lines. Formulators must consider that vip peptide is sensitive to pH extremes; optimal stability is achieved in formulations with pH 5.5-6.5 and with the inclusion of antioxidants like vitamin E or sodium metabisulfite.

In laboratory research, VIP peptide is used for receptor binding assays, cell signaling pathway studies, and neuroimmunology experiments. Research-grade material requires the highest purity (≥99%) and comes with detailed batch-specific documentation. Bulk orders for academic institutions often range from 10 mg to 500 mg, with custom packaging options such as argon-flushed vials to prevent oxidation.

For wholesale buyers, the most common usage scenario involves bulk procurement for distribution to formulators and labs. A typical wholesale order of vip peptide ranges from 1 gram to 100 grams, with pricing that decreases significantly at higher volumes. Buyers should request stability data specific to their intended application—lyophilized powder for long-term storage or pre-weighed aliquots for immediate use.

vip peptide VS Ordinary Low-Grade Peptides

Low-grade peptides often contain deletion sequences that can act as receptor antagonists, reducing the efficacy of the active ingredient. For B2B buyers, the cost savings from purchasing inferior vip peptide are quickly negated by formulation failures, rejected batches, and lost customer trust. High-grade material ensures reproducible results in both research and commercial applications.

Bulk Purchase Selection Guide

Navigating the wholesale market for vip peptide requires awareness of common pitfalls. The most frequent issue is purity misrepresentation—some suppliers quote "98% purity" but use a non-standard HPLC method that excludes small impurity peaks. Always request the raw HPLC chromatogram with integration parameters. Another common problem is incorrect salt form; VIP peptide is typically supplied as a trifluoroacetate (TFA) salt, which can affect solubility and biological activity if not properly accounted for in formulation.

Selection standards for bulk buyers include:

• Manufacturing Transparency: Suppliers should disclose their synthesis method (SPPS vs. recombinant), purification process, and quality control protocols.
• Batch Consistency: Request three consecutive batch CoAs to verify that purity and impurity profiles are reproducible.
• Packaging Integrity: Lyophilized peptide must be sealed under inert gas (argon or nitrogen) in amber glass vials to prevent moisture absorption and photodegradation.
• Lead Time: Standard lead time for custom synthesis is 2-4 weeks; stock items can ship within 3-5 business days.

A buyer checklist for first-time orders should include: requesting a sample (10-25 mg) for in-house testing, verifying the supplier's ISO or GMP certification, and confirming that the Certificate of Analysis includes all requested tests. For international shipments, ensure that the supplier provides a Material Safety Data Sheet (MSDS) and handles customs documentation for peptide raw materials.

Core Product Advantages

Professional-grade vip peptide offers three distinct advantages that justify its premium positioning in the B2B market. First, purity consistency across batches ensures that formulators and researchers can rely on predictable performance. Each batch is tested by HPLC and MS, with results archived for at least five years. This traceability is essential for companies that need to replicate results or respond to regulatory inquiries.

Second, stability optimization through advanced lyophilization techniques extends shelf life and reduces the risk of degradation during transport. The peptide is packaged in low-bind vials with desiccant, and each shipment includes a temperature data logger for cold-chain verification. For cosmetic manufacturers, this means fewer quality complaints and longer product shelf life.

Third, cost performance is achieved through direct manufacturing relationships and volume-based pricing. Buyers who commit to annual contracts or bulk orders (10 grams or more) receive preferential pricing without sacrificing quality. Technical support from PhD-level chemists is included with every wholesale account, providing formulation guidance and troubleshooting for complex applications. This combination of purity, stability, and support makes high-grade vip peptide the most cost-effective choice for serious B2B buyers.

Frequently Asked Questions

Q1: What is the minimum order quantity (MOQ) for wholesale VIP peptide, and can I request a custom purity specification?
Most suppliers set the MOQ at 1 gram for stock items, with custom synthesis available for orders of 5 grams or more. Custom purity specifications (e.g., 99.5% minimum) are possible but require additional purification steps and quality control testing, which may extend lead time by 1-2 weeks. Always confirm the MOQ and custom options before placing an order.

Q2: How should I verify the authenticity of a VIP peptide Certificate of Analysis from a new supplier?
Cross-reference the HPLC chromatogram with the reported purity percentage—the main peak should be clearly separated from any impurity peaks. Request the MS spectrum to confirm molecular weight, and ask for the amino acid analysis report to verify composition. Reputable suppliers will provide these documents without hesitation and may offer a video call to walk through the data.

Q3: What are the shipping and storage requirements for bulk VIP peptide orders to maintain stability?
Bulk orders must be shipped on dry ice or with cold packs to maintain temperatures below -20°C during transit. Upon receipt, store the lyophilized powder at -20°C in a freezer with minimal temperature fluctuations. Avoid repeated freeze-thaw cycles; if you need multiple aliquots, request pre-weighed vials from the supplier. Reconstituted peptide should be used immediately or stored at 2-8°C for no more than 72 hours.